PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 333aa    MW: 36169.1 Da    PI: 9.5337
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110278.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822201.23.3e-62171572145
          DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslq 95 
                     +++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc eAGwvve+DGttyrkg kp+    ++agss++a+p ss++
  XP_009110278.1  17 ATRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPPsLPGDVAGSSSRATPYSSYN 111
                     789************************************************************************8899**************99 PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                          s ++sp+ sy+ sp+sssfpsps+    ++++ ++++p+l++ + 
  XP_009110278.1 112 ----QSPFESPILSYQVSPSSSSFPSPSRGGGDTHNNISTIFPFLRNGGI 157
                     ....889**********************999988888999999998864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.3E-5918139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MTSDGATSTS AAAAMAATRR KPSWRERENN RRRERRRRAV AAKIYTGLRA QGNYNLPKHC  60
DNNEVLKALC SEAGWVVEED GTTYRKGHKP PSLPGDVAGS SSRATPYSSY NQSPFESPIL  120
SYQVSPSSSS FPSPSRGGGD THNNISTIFP FLRNGGIPSS LPPLRISNSA PVTPPVSSPS  180
SKHPKALSTW GECFTNQSAK QSMSSFNYPF YAVSAPASPT HHRQFNAPPA TIPECDESDA  240
STVDSGHWIS FQKFSQQQPF LGVSAVPASP TFNLVRPPVP KQLSPNTGAT QEIGQSSEFK  300
FENSQVKPWE GERIHDVAME DLELTLGNAK GRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11837RRKPSWRERENNRRRERRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.65170.0bud| flower| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110278.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
SwissprotQ9LN631e-172BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBLM4DJ300.0M4DJ30_BRARP; Uncharacterized protein
STRINGBra016508.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-150BES1 family protein